PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G005600.1.p
Common NameGLYMA_17G005600, LEC1-B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 227aa    MW: 25581.7 Da    PI: 7.1714
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G005600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.45.6e-5549145197
                NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                          vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++y
  Glyma.17G005600.1.p  49 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTMYLHRY 138
                          69**************************************************************************************** PP

                NF-YB  91 relegek 97 
                          releg++
  Glyma.17G005600.1.p 139 RELEGDR 145
                          *****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-5144152IPR009072Histone-fold
SuperFamilySSF471131.12E-3852151IPR009072Histone-fold
PfamPF008084.7E-2655119IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.6E-1783101No hitNo description
PROSITE patternPS00685086102IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.6E-17102120No hitNo description
PRINTSPR006157.6E-17121139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
METGGFHGYR KLPNTTAGLK LSVSDMNMRQ QVASSDHSAA TGEENECTVR EQDRFMPIAN  60
VIRIMRKILP PHAKISDDAK ETIQECVSEY ISFITGEANE RCQREQRKTI TAEDVLWAMS  120
KLGFDDYIEP LTMYLHRYRE LEGDRTSMRG EPLGKRTVEY ATLGVATAFV PPPYHHHNGY  180
FGAAMPMGTY VREAPPNTAS SHHHHHHHHH HARGISNAHE PNARSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4048140193NF-YB
4awl_B4e-4048140294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4048140294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.278310.0cotyledon| pod| somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0882890.0EU088289.1 Glycine max transcription factor LEC1-B (LEC1-B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001239679.11e-171nuclear transcription factor Y subunit B-6-like
SwissprotQ84W662e-76NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0B2P7931e-171A0A0B2P793_GLYSO; Nuclear transcription factor Y subunit B-6
TrEMBLB5KMS91e-171B5KMS9_SOYBN; Transcription factor LEC1-B
STRINGGLYMA17G00950.11e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.11e-77nuclear factor Y, subunit B6